PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.21132s0011.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 840aa    MW: 92316 Da    PI: 6.0473
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.21132s0011.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.71.7e-172482357
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          k  ++t+eq+e+Le+++ ++++p+  +r++L +++    +++ +q+kvWFqNrR ++k+
  Bostr.21132s0011.1.p 24 KYVRYTAEQVEALERVYSECPKPTSLRRQQLIRECpilaHIDSKQIKVWFQNRRCRDKQ 82
                          56789***************************************************996 PP

2START158.94.1e-501573642204
                           HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT.. CS
                 START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg.. 88 
                           +aee+++e+++ka+ ++  Wv+++ +++g++++ +f+ s+ ++g a+ra+g+v  +++   +e+l+d++ W +++++ e+      g  
  Bostr.21132s0011.1.p 157 IAEETLAEFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQRCNGVAARACGLVSLEPM-KIAEILKDRPSWFRDCRSLEVFTMFPAGng 244
                           68999*****************************************************.7777777777***********999999999 PP

                           EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
                 START  89 galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlk 173
                           g+++l +++++a++ l+p Rdf+++Ry+ +l  g++v++++S++     p+    +++vRae+lpSg+li+p+++g+s +++v+h++l+
  Bostr.21132s0011.1.p 245 GTIELVYMQSYAPTSLAPaRDFWTLRYTTSLDNGSLVVCERSLSGSGAGPSpssAAQFVRAEMLPSGYLIRPCEGGGSIIHIVDHINLE 333
                           ********************************************9888887778999******************************** PP

                           SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                 START 174 grlphwllrslvksglaegaktwvatlqrqc 204
                           g++++ +lr++++s+ + ++k++ a+l++ +
  Bostr.21132s0011.1.p 334 GWSVPDVLRPFYESSKVVAQKMTIAALRHIR 364
                           **************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.9331983IPR001356Homeobox domain
SMARTSM003891.3E-132187IPR001356Homeobox domain
SuperFamilySSF466896.84E-162186IPR009057Homeodomain-like
CDDcd000863.60E-142484No hitNo description
PfamPF000465.0E-152582IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-172679IPR009057Homeodomain-like
CDDcd146861.03E-576114No hitNo description
Gene3DG3DSA:1.20.5.1707.1E-480129No hitNo description
PROSITE profilePS5084826.613147375IPR002913START domain
CDDcd088752.66E-69151367No hitNo description
Gene3DG3DSA:3.30.530.202.9E-20155360IPR023393START-like domain
SMARTSM002342.4E-41156366IPR002913START domain
SuperFamilySSF559611.51E-34157367No hitNo description
PfamPF018527.4E-48157364IPR002913START domain
PfamPF086702.9E-49691838IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 840 aa     Download sequence    Send to blast
MAMALANHHE SGDNINRHLD SSGKYVRYTA EQVEALERVY SECPKPTSLR RQQLIRECPI  60
LAHIDSKQIK VWFQNRRCRD KQRKEASRLQ SVNRKLSAIN KLLMEENDRL QKQVGQLVCE  120
NGYMKQQLTT VVTDDSVDAT PQHSLRDANS PAGLIAIAEE TLAEFLSKAT GTAVDWVQMP  180
GMKPGPDSVG IFAISQRCNG VAARACGLVS LEPMKIAEIL KDRPSWFRDC RSLEVFTMFP  240
AGNGGTIELV YMQSYAPTSL APARDFWTLR YTTSLDNGSL VVCERSLSGS GAGPSPSSAA  300
QFVRAEMLPS GYLIRPCEGG GSIIHIVDHI NLEGWSVPDV LRPFYESSKV VAQKMTIAAL  360
RHIRQIAHET NGEVSYGLGR QPAVLRTFSQ RLSRGFNDAV NGFNDDGWSI MSCNGAEDII  420
VAVNSTKHLN NISDSLSFLR GVLCAKASML LDNVPPAVLI RFLREHQSEW ANFNVDAYSA  480
ATLKAGAFSY PGMRPTRFTG SQIVMPLGHT IENEEMLEVV RLEGHSLVQE DSFVSRDVHL  540
LQICTGIDEN AVGACSELVF APINEMFPDD APLVPSGFRV IPIDAKTGEA QDLLAINHQT  600
LDLTSSLDVG PASEHAATGN LSSNHSSRCI LTIAFQFPFE NNLQDNVANM ACQYVRTVIS  660
LVHRVAMAVS PSGLNQSFSS KLSPGSLEAV TLAMWICQSY NQHLGSDLLR TDSLGGDSLL  720
RQLWDHQDAI LCCSLKPQPV FMFANQAGLD MLETTLVALQ DITLEKIFDE SGRKALCPDF  780
AKLMQQGFAC LPSGICVSTM GRHVSYEQAV SWKVFADSEN NNNNNIHCLA FLFVNWSFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280004.10.0hypothetical protein CARUB_v10025876mg
SwissprotQ9SE430.0REV_ARATH; Homeobox-leucine zipper protein REVOLUTA
TrEMBLR0EUU00.0R0EUU0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.8__2034__AT5G60690.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47792754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.10.0HD-ZIP family protein